PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g047880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 163aa    MW: 18028 Da    PI: 10.9334
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g047880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind250.88.9e-7721162159301
       GAGA_bind 159 pkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrga 253
                      k+ k k ++kk+++s k++k+ s  +++k+ekk++d++++  s+D+s++P+PvCsCtG++r+CYkWG+GGWqS+CCt++iS+yPLP+st+r+ga
  Csa04g047880.1  21 SKALKPKTPRKKRSASYKSKKTLSI-PETKREKKNLDINIDISSFDTSGVPPPVCSCTGVSRVCYKWGMGGWQSSCCTISISTYPLPMSTTRPGA 114
                     4666777777777888777777776.699****************************************************************** PP

       GAGA_bind 254 RiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     R+agrKmS+ga+ klL++La+eGy+ls+pvDLk+hWA+HGtnkfvt +
  Csa04g047880.1 115 RLAGRKMSNGAYVKLLARLAGEGYSLSHPVDLKNHWARHGTNKFVTFK 162
                     **********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.8E-611162IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-6622162IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MITETVWKPW NRSPRISLPP SKALKPKTPR KKRSASYKSK KTLSIPETKR EKKNLDINID  60
ISSFDTSGVP PPVCSCTGVS RVCYKWGMGG WQSSCCTISI STYPLPMSTT RPGARLAGRK  120
MSNGAYVKLL ARLAGEGYSL SHPVDLKNHW ARHGTNKFVT FK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0899620.0EU089962.1 Olimarabidopsis pumila GAGA-binding transcriptional activator (BBR/BPC7) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010516733.11e-100PREDICTED: protein BASIC PENTACYSTEINE7-like
SwissprotO822861e-95BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLA7UN692e-95A7UN69_OLIPU; GAGA-binding transcriptional activator (Fragment)
STRINGAT2G35550.14e-93(Arabidopsis thaliana)
STRINGfgenesh2_kg.4__1574__AT2G35550.41e-93(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM136742127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.45e-89basic pentacysteine 7